PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02081.30
Common NameJCGZ_12803, LOC105637317
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ZF-HD
Protein Properties Length: 340aa    MW: 37675.2 Da    PI: 9.375
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02081.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.64.6e-31124179460
    ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                    vrY+eClkNhAas Gg +vDGCgEfmp+ geegta+al+CaAC+CHRnFHR+e + e
  Jcr4S02081.30 124 VRYRECLKNHAASKGGFVVDGCGEFMPT-GEEGTAEALRCAACQCHRNFHRKEIDGE 179
                    89*************************8.999********************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-22124177IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.9E-29124176IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.7E-29125176IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.364126175IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.79E-19266337IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-29270338IPR009057Homeodomain-like
PROSITE profilePS500718.519274338IPR001356Homeobox domain
TIGRFAMsTIGR015657.0E-27276333IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEVRGQEKGI AMPSSLGCNP TNRDSSSKVP SSNILSAFGE TKEDDHHHHH QNLERYPLFH  60
HHQMNLQNLP LKPTGGPEQT QDPTPAPAMI TAVSANNRVA SVPSRSSSRS PPAPPGPPTS  120
TGLVRYRECL KNHAASKGGF VVDGCGEFMP TGEEGTAEAL RCAACQCHRN FHRKEIDGEH  180
QSAATNSYYK DNNQRNTIPQ QQLATSHPPI SQPSVHYHHR YPHGLTLGAP TTTPAPTIVM  240
TFGGGGAAAE SSSEDLNMFQ SNVQGYGSIQ PSSLSKKRFR TKFSQEQKEK MLEFAEKIEW  300
KIQKQDEQEV QQFCSKVGVK RKVFKVWMHN NKQAMKKKQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-212773321873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012076140.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW76e-69ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A067KRE00.0A0A067KRE0_JATCU; Uncharacterized protein
STRINGPOPTR_0007s12970.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-57homeobox protein 24
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]